Печать
MONOCLONAL ANTI-CD3Z
Кат. №: WH0000919M1-100UG
Производитель: Sigma-Aldrich
Кол-во:
Цена по запросу
Товар оформляется под заказ
Печать
MONOCLONAL ANTI-CD3Z
Кат. №: WH0000919M1-100UG
Производитель: Sigma-Aldrich
Кол-во:
Цена по запросу
Товар оформляется под заказ
Кол-во:
Цена по запросу
Товар оформляется под заказ
Description_x000D_
General description_x000D_
T cell antigen receptor ζ chain (CD3 ζ), also known as CD247 gene, spanning 88kb of genomic DNA, is mapped to human chromosome 1q24.2._x000D_
The protein encoded by this gene is T-cell receptor ζ, which together with T-cell receptor α/β and γ/δ heterodimers, and with CD3-γ, -δ and -ε, forms the T-cell receptor-CD3 complex. The ζ chain plays an important role in coupling antigen recognition to several intracellular signal-transduction pathways. Low expression of the antigen results in impaired immune response. Two alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. (provided by RefSeq)_x000D_
Immunogen_x000D_
CD3Z (AAH25703, 1 a.a. ~ 164 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa._x000D_
Sequence_x000D_
MKWKALFTAAILQAQLPITEAQSFGLLDPKLCYLLDGILFIYGVILTALFLRVKFSRSADAPAYQQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPQRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDTYDALHMQALPPR_x000D_
Physical form_x000D_
Solution in phosphate buffered saline, pH 7.4_x000D_
Disclaimer_x000D_
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals._x000D_
Legal Information_x000D_
GenBank is a registered trademark of United States Department of Health and Human Services_x000D_
Biochem/physiol Actions_x000D_
T cell antigen receptor ζ chain (CD3ζ) functions as a key signal transduction component of the T cell antigen receptor (TCR) complex. The encoded protein facilitates optimal effector T-cell function by enhancing receptor expression and signaling. Mutation in the gene increases the risk of susceptibility to systemic lupus erythematosus (SLE). Reduced expression of the gene has been observed in T-cells of cancer, lupus and chronic infectious diseases such as leprosy and tuberculosis patients. CD3 ζ serves as a potent biomarker for determining progression and severity in patients with type 2 diabetes.
Related Categories
Alphabetical Index, Antibodies, CD0-CDC, Primary Antibodies conjugate
Дорогой клиент, на сайте внедрена нейросеть для сбора информации о товаре. Это может привести к незначительным расхождениям в характеристиках продукции.
