Description_x000D_ General description_x000D_ CITED4 (Cbp (CREB-binding protein)/p300-interacting transactivator 4) gene is mapped to human chromosome 1p34.2._x000D_ Immunogen_x000D_ CITED4 (NP_597724.1, 131 a.a. ~ 184 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa._x000D_ Sequence_x000D_ GMDAELIDEEALTSLELELGLHRVRELPELFLGQSEFDCFSDLGSAPPAGSVSC_x000D_ Physical form_x000D_ Solution in phosphate buffered saline, pH 7.4_x000D_ Biochem/physiol Actions_x000D_ CITED4 (Cbp (CREB-binding protein)/p300-interacting transactivator 4) is a transcriptional cofactor. It is found to be downregulated in some of the tumor types including colorectal cancer. It is involved in the regulation of TGFB (transforming growth factor β1), TFAP2 (transcription factor A) and HIF1A (hypoxia inducible factor 1 αsubunit). It prevents the transactivation of HIF1A by inhibiting its binding to p300. CITED4 is known to be involved in the development of neural crest and neural tube._x000D_ Features and Benefits_x000D_ Evaluate our antibodies with complete peace of mind. If the antibody does not perform in your application, we will issue a full credit or replacement antibody. Learn more.