Description_x000D_ General description_x000D_ The protein encoded by this gene is a subunit of the CCR4-NOT core transcriptional regulation complex. The encoded protein has a 3′-5′ RNase activity and prefers polyadenylated substates. (provided by RefSeq)_x000D_ Immunogen_x000D_ CNOT6 (NP_056270.2, 112 a.a. ~ 210 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa._x000D_ Sequence_x000D_ LPFELGKLFQLQTLGLKGNPLTQDILNLYQEPDGTRRLLNYLLDNLSGTAKRITTEQPPPRSWIMLQEPDRTRPTALFSVMCYNVLCDKYATRQLYGYC_x000D_ Physical form_x000D_ Solution in phosphate buffered saline, pH 7.4