Description_x000D_ General description_x000D_ This gene encodes a kinase that specifically phosphorylates the N-terminal region of the non-collagenous domain of the alpha 3 chain of type IV collagen, known as the Goodpasture antigen. Goodpasture disease is the result of an autoimmune response directed at this antigen. One isoform of this protein is also involved in ceramide intracellular transport. Three transcript variants encoding different isoforms have been found for this gene. (provided by RefSeq)_x000D_ Immunogen_x000D_ COL4A3BP (NP_112729, 499 a.a. ~ 598 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa._x000D_ Sequence_x000D_ TWIVCNFSVDHDSAPLNNRCVRAKINVAMICQTLVSPPEGNQEISRDNILCKITYVANVNPGGWAPASVLRAVAKREYPKFLKRFTSYVQEKTAGKPILF_x000D_ Physical form_x000D_ Solution in phosphate buffered saline, pH 7.4_x000D_ Legal Information_x000D_ GenBank is a registered trademark of United States Department of Health and Human Services