Description_x000D_ General description_x000D_ Cryptochrome circadian regulator 2 (CRY2) is a core circadian gene and transcriptional repressor. CRY2 gene is located on the human chromosome 11p11.2._x000D_ Immunogen_x000D_ CRY2 (NP_066940.1, 141 a.a. ~ 231 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa._x000D_ Sequence_x000D_ VEVVTENSHTLYDLDRIIELNGQKPPLTYKRFQAIISRMELPKKPVGLVTSQQMESCRAEIQENHDETYGVPSLEELGFPTEGLGPAVWQG_x000D_ Physical form_x000D_ Solution in phosphate buffered saline, pH 7.4_x000D_ Biochem/physiol Actions_x000D_ Cryptochrome circadian regulator 2 (CRY2) is involved in DNA damage checkpoint control and cell cycle progression. It maintains the circadian rhythm through a circadian feedback loop. It is also important in immune system coordination and hematologic system development. CRY2 is a potential circadian biomarker for non-Hodgkin′s lymphoma (NHL). CRY2 is linked to rapid cycling in bipolar disorder. CRY2 functions as light-sensitive magnetosensor.