Description_x000D_ General description_x000D_ The gene CTBS (chitobiase) is mapped to human chromosome 1p22. The gene spans a length of approximately 20kb with seven exons interspaced by six introns. The 5′-flanking region of human chitobiase gene is rich in GC-content._x000D_ Immunogen_x000D_ CTBS (AAH24007.2, 37 a.a. ~ 105 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa._x000D_ Sequence_x000D_ DCPCPEPELCRPIRHHPDFEVFVFDVGQKTWKSYDWSQITTVATFGKYDSELMCYAHSKGARVVLKGNL_x000D_ Physical form_x000D_ Solution in phosphate buffered saline, pH 7.4_x000D_ Legal Information_x000D_ GenBank is a registered trademark of United States Department of Health and Human Services_x000D_ Biochem/physiol Actions_x000D_ The gene CTBS (chitobiase) encodes a lysosomal glycosidase that functions in the degradation of asparagine-linked glycoproteins. It cleaves the reducing-end N-Acetylglucosamine residues from the chitobiose core of oligosaccharides.