Description_x000D_ General description_x000D_ Doublecortin like kinase 1 (DCAMKL1) is a kinase protein. The gene is located on human chromosome 13q13.3. It is majorly expressed in fetal brain. The protein has two domains, doublecortin (DC) domain and a calmodulin-dependent kinase (CaM kinase) like domain._x000D_ Immunogen_x000D_ DCAMKL1 (NP_004725, 640 a.a. ~ 729 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa._x000D_ Sequence_x000D_ QVLEHPWVNDDGLPENEHQLSVAGKIKKHFNTGPKPNSTAAGVSVIALDHGFTIKRSGSLDYYQQPGMYWIRPPLLIRRGRFSDEDATRM_x000D_ Physical form_x000D_ Solution in phosphate buffered saline, pH 7.4_x000D_ Disclaimer_x000D_ Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals._x000D_ Legal Information_x000D_ GenBank is a registered trademark of United States Department of Health and Human Services_x000D_ Biochem/physiol Actions_x000D_ Doublecortin like kinase 1 (DCAMKL1) acts as a tumor stem cell marker in colon cancer, pancreatic cancer and other cancers. It is used as a therapeutic target against invasion, migration, focal adhesion and stemness, which is overexpressed in renal clear cell carcinoma (RCC) tumors. Doublecortin (DC) domain helps in the development of nervous system and calmodulin-dependent kinase (CaM kinase) domain regulates cellular functions, such as muscle contraction, neurotransmitter release and cell proliferation. This protein controls the microtubule polymerization in migrating neurons.