Description_x000D_ General description_x000D_ DLL1 is a human homolog of the Notch Delta ligand and is a member of the delta/serrate/jagged family. It plays a role in mediating cell fate decisions during hematopoiesis. It may play a role in cell-to-cell communication. (provided by RefSeq)_x000D_ Immunogen_x000D_ DLL1 (NP_005609, 18 a.a. ~ 109 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa._x000D_ Sequence_x000D_ QVWSSGVFELKLQEFVNKKGLLGNRNCCRGGAGPPPCACRTFFRVCLKHYQASVSPEPPCTYGSAVTPVLGVDSFSLPDGGGADSAFSNPIR_x000D_ Physical form_x000D_ Solution in phosphate buffered saline, pH 7.4