Перейти к контенту
Main image
Печать
MONOCLONAL ANTI-DPYS
Кат. №: WH0001807M1-100UG
Производитель: Sigma-Aldrich
Кол-во:
Цена по запросу
Товар оформляется под заказ
Печать
MONOCLONAL ANTI-DPYS
Main image
Кат. №: WH0001807M1-100UG
Производитель: Sigma-Aldrich
Кол-во:
Цена по запросу
Товар оформляется под заказ
Main image
Печать
MONOCLONAL ANTI-DPYS
Кат. №: WH0001807M1-100UG
Производитель: Sigma-Aldrich
Кол-во:
Цена по запросу
Товар оформляется под заказ
Description_x000D_ General description_x000D_ Dihydropyrimidinase catalyzes the conversion of 5,6-dihydrouracil to 3-ureidopropionate in pyrimidine metabolism. Dihydropyrimidinase is expressed at a high level in liver and kidney as a major 2.5-kb transcript and a minor 3.8-kb transcript. Defects in the DPYS gene are linked to dihydropyrimidinuria. (provided by RefSeq)_x000D_ The gene DPYS (dihydropyrimidinase) is mapped to human chromosome 8q22. It is mainly expressed in the liver and kidney cells._x000D_ Immunogen_x000D_ DPYS (NP_001376, 422 a.a. ~ 519 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa._x000D_ Sequence_x000D_ AVNFNIFEGMVCHGVPLVTISRGKVVYEAGVFSVTAGDGKFIPRKPFAEYIYKRIKQRDRTCTPTPVERAPYKGEVATLKSRVTKEDATAGTRKQAHP_x000D_ Physical form_x000D_ Solution in phosphate buffered saline, pH 7.4_x000D_ Legal Information_x000D_ GenBank is a registered trademark of United States Department of Health and Human Services_x000D_ Biochem/physiol Actions_x000D_ DPYS (dihydropyrimidinase) is an enzyme of the pyrimidine degradation pathway and is responsible for the ring opening of 5,6-dihydrouracil and 5,6-dihydrothymine. Mutations in the DPYS gene can lead to dihydropyrimidinase deficiency, associated with a large accumulation of dihydrouracil and dihydrothymine in urine, blood and cerebrospinal fluid. Methylation pattern in DPYS gene might predict prostate cancer-related mortality.{33)_x000D_ Features and Benefits_x000D_ Evaluate our antibodies with complete peace of mind. If the antibody does not perform in your application, we will issue a full credit or replacement antibody. Learn more.
Related Categories
Alphabetical Index, Antibodies, DM-DP, Primary Antibodies conjugate
Дорогой клиент, на сайте внедрена нейросеть для сбора информации о товаре. Это может привести к незначительным расхождениям в характеристиках продукции.
Description_x000D_ General description_x000D_ Dihydropyrimidinase catalyzes the conversion of 5,6-dihydrouracil to 3-ureidopropionate in pyrimidine metabolism. Dihydropyrimidinase is expressed at a high level in liver and kidney as a major 2.5-kb transcript and a minor 3.8-kb transcript. Defects in the DPYS gene are linked to dihydropyrimidinuria. (provided by RefSeq)_x000D_ The gene DPYS (dihydropyrimidinase) is mapped to human chromosome 8q22. It is mainly expressed in the liver and kidney cells._x000D_ Immunogen_x000D_ DPYS (NP_001376, 422 a.a. ~ 519 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa._x000D_ Sequence_x000D_ AVNFNIFEGMVCHGVPLVTISRGKVVYEAGVFSVTAGDGKFIPRKPFAEYIYKRIKQRDRTCTPTPVERAPYKGEVATLKSRVTKEDATAGTRKQAHP_x000D_ Physical form_x000D_ Solution in phosphate buffered saline, pH 7.4_x000D_ Legal Information_x000D_ GenBank is a registered trademark of United States Department of Health and Human Services_x000D_ Biochem/physiol Actions_x000D_ DPYS (dihydropyrimidinase) is an enzyme of the pyrimidine degradation pathway and is responsible for the ring opening of 5,6-dihydrouracil and 5,6-dihydrothymine. Mutations in the DPYS gene can lead to dihydropyrimidinase deficiency, associated with a large accumulation of dihydrouracil and dihydrothymine in urine, blood and cerebrospinal fluid. Methylation pattern in DPYS gene might predict prostate cancer-related mortality.{33)_x000D_ Features and Benefits_x000D_ Evaluate our antibodies with complete peace of mind. If the antibody does not perform in your application, we will issue a full credit or replacement antibody. Learn more.
Related Categories
Alphabetical Index, Antibodies, DM-DP, Primary Antibodies conjugate
Дорогой клиент, на сайте внедрена нейросеть для сбора информации о товаре. Это может привести к незначительным расхождениям в характеристиках продукции.