Description_x000D_ General description_x000D_ Members of the CRMP family, such as DPYSL5, are believed to play a role in growth cone guidance during neural development.[supplied by OMIM_x000D_ Immunogen_x000D_ DPYSL5 (NP_064519, 466 a.a. ~ 564 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa._x000D_ Sequence_x000D_ SFPDTVYKKLVQREKTLKVRGVDRTPYLGDVAVVVHPGKKEMGTPLADTPTRPVTRHGGMRDLHESSFSLSGSQIDDHVPKRASARILAPPGGRSSGIW_x000D_ Physical form_x000D_ Solution in phosphate buffered saline, pH 7.4_x000D_ Features and Benefits_x000D_ Evaluate our antibodies with complete peace of mind. If the antibody does not perform in your application, we will issue a full credit or replacement antibody. Learn more.