Перейти к контенту
Main image
Печать
MONOCLONAL ANTI-EIF4EBP3
Кат. №: SAB1400319-100UG
Производитель: Sigma-Aldrich
Кол-во:
Цена по запросу
Товар оформляется под заказ
Печать
MONOCLONAL ANTI-EIF4EBP3
Main image
Кат. №: SAB1400319-100UG
Производитель: Sigma-Aldrich
Кол-во:
Цена по запросу
Товар оформляется под заказ
Main image
Печать
MONOCLONAL ANTI-EIF4EBP3
Кат. №: SAB1400319-100UG
Производитель: Sigma-Aldrich
Кол-во:
Цена по запросу
Товар оформляется под заказ
Description_x000D_ General description_x000D_ This gene encodes a member of the EIF4EBP family which derives it name from proteins that bind to eukaryotic initiation factor 4E and that prevent its assembly into EIF4F. Co-transcription of this gene and the neighboring upstream gene (MASK) generates a transcript (MASK-BP3) which encodes a fusion protein comprised of the MASK protein sequence for the majority of the protein and a different C-terminus due to an alternate reading frame for the EIF4EBP3 segments. (provided by RefSeq)_x000D_ Immunogen_x000D_ EIF4EBP3 (NP_003723, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa._x000D_ Sequence_x000D_ MSTSTSCPIPGGRDQLPDCYSTTPGGTLYATTPGGTRIIYDRKFLLECKNSPIARTPPCCLPQIPGVTTPPTAPLSKLEELKEQETEEEIPDDAQFEMDI_x000D_ Physical form_x000D_ Solution in phosphate buffered saline, pH 7.4
Related Categories
Alphabetical Index, Antibodies, E-EI, Primary Antibodies conjugate
Дорогой клиент, на сайте внедрена нейросеть для сбора информации о товаре. Это может привести к незначительным расхождениям в характеристиках продукции.
Description_x000D_ General description_x000D_ This gene encodes a member of the EIF4EBP family which derives it name from proteins that bind to eukaryotic initiation factor 4E and that prevent its assembly into EIF4F. Co-transcription of this gene and the neighboring upstream gene (MASK) generates a transcript (MASK-BP3) which encodes a fusion protein comprised of the MASK protein sequence for the majority of the protein and a different C-terminus due to an alternate reading frame for the EIF4EBP3 segments. (provided by RefSeq)_x000D_ Immunogen_x000D_ EIF4EBP3 (NP_003723, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa._x000D_ Sequence_x000D_ MSTSTSCPIPGGRDQLPDCYSTTPGGTLYATTPGGTRIIYDRKFLLECKNSPIARTPPCCLPQIPGVTTPPTAPLSKLEELKEQETEEEIPDDAQFEMDI_x000D_ Physical form_x000D_ Solution in phosphate buffered saline, pH 7.4
Related Categories
Alphabetical Index, Antibodies, E-EI, Primary Antibodies conjugate
Дорогой клиент, на сайте внедрена нейросеть для сбора информации о товаре. Это может привести к незначительным расхождениям в характеристиках продукции.