Description_x000D_ General description_x000D_ EXOC7 is a component of the exocyst, which is an evolutionarily conserved octameric protein complex essential for exocytosis. The exocyst targets secretory vesicles at specific domains of the plasma membrane for cell surface expansion and protein secretion (Zuo et al., 2006 [PubMed 17086175]).[supplied by OMIM_x000D_ Immunogen_x000D_ EXOC7 (NP_001013861, 586 a.a. ~ 684 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa._x000D_ Sequence_x000D_ VFQPGVKLRDKERQIIKERFKGFNDGLEELCKIQKAWAIPDTEQRDRIRQAQKTIVKETYGAFLQKFGSVPFTKNPEKYIKYGVEQVGDMIDRLFDTSA_x000D_ Physical form_x000D_ Solution in phosphate buffered saline, pH 7.4_x000D_ Disclaimer_x000D_ Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals._x000D_ Legal Information_x000D_ GenBank is a registered trademark of United States Department of Health and Human Services_x000D_ Biochem/physiol Actions_x000D_ EXOC7 (Exocyst complex component 7) is mainly involved in the exocytosis, a membrane trafficking process of intracellular protein elements such as hormones and neurotransmitters, membrane proteins and lipids to specific domains of the plasma membrane. Exocytosis plays a vital role in the cellular growth, development and cell polarity establishment. During exocytosis, it directly connects with the plasma membrane through its direct interaction with phosphatidylinositol 4,5-bisphosphate (PI(4,5)P(2)). It has also been reported that the interaction between EXOC7 and PI(4,5)P(2) is highly essential for the docking and fusion of post-Golgi secretory vesicles.