Description_x000D_ General description_x000D_ General control of amino acid synthesis protein 5-like2 (GCN5L2) also known as KAT2A, or GCN5, is a histone acetyltransferase (HAT) that functions primarily as a transcriptional activator. It also functions as a repressor of NF-kappa-B (see MIM 164011) by promoting ubiquitination of the NF-kappa-B subunit RELA (MIM 164014) in a HAT-independent manner (Mao et al., 2009 [PubMed 19339690]).[supplied by OMIM]GCN5L2 gene is located on human chromosome 17q21.2. This protein is expressed in ovaries._x000D_ Immunogen_x000D_ GCN5L2 (AAH32743, 738 a.a. ~ 837 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa._x000D_ Sequence_x000D_ KNLLAQIKSHPSAWPFMEPVKKSEAPDYYEVIRFPIDLKTMTERLRSRYYVTRKLFVADLQRVIANCREYNPPDSEYCRCASALEKFFYFKLKEGGLIDK_x000D_ Physical form_x000D_ Solution in phosphate buffered saline, pH 7.4_x000D_ Disclaimer_x000D_ Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals._x000D_ Legal Information_x000D_ GenBank is a registered trademark of United States Department of Health and Human Services_x000D_ Biochem/physiol Actions_x000D_ General control of amino acid synthesis protein 5-like2 (GCN5L2) regulates periodontitis through acetylation of dickkopf-related protein 1 (DKK1). It regulates early region 1A (E1A) dependant transactivation of human adenovirus. The protein modulates osteogenic differentiation of mesenchymal stem cells by blocking NF-κB (nuclear factor-κB) signalling pathway. GCN5 interacts with (origin recognition complex subunit 5) Orc5 and improves the chromatin-opening function of Orc5.