Description_x000D_ General description_x000D_ Geminin (GMNN) is a nuclear regulator protein encoded by GMNN gene. This gene is located on human chromosome 6p22.3. It is expressed in the the cell cycle during S, G2 and M phases._x000D_ Immunogen_x000D_ GMNN (AAH05185, 110 a.a. ~ 209 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa._x000D_ Sequence_x000D_ LYEALKENEKLHKEIEQKDNEIARLKKENKELAEVAEHVQYMAELIERLNGEPLDNFESLDNQEFDSEEETVEDSLVEDSEIGTCAEGTVSSSTDAKPCI_x000D_ Physical form_x000D_ Solution in phosphate buffered saline, pH 7.4_x000D_ Disclaimer_x000D_ Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals._x000D_ Legal Information_x000D_ GenBank is a registered trademark of United States Department of Health and Human Services_x000D_ Biochem/physiol Actions_x000D_ Geminin (GMNN) prevents replication of DNA. It participates in cancer pathophysiology and developmental process. This protein also participates in several stages of development like pre-implantation, germ layer formation, cell commitment and specification. It also has roles in the maintenance of genome integrity at mid blastula transition, epithelial to mesenchymal transition during gastrulation, neural development, organogenesis and axis patterning. GMNN controls chromatin remodeling.