Перейти к контенту
Main image
Печать
MONOCLONAL ANTI-GTF3A
Кат. №: SAB1409159-100UG
Производитель: Sigma-Aldrich
Кол-во:
Цена по запросу
Товар оформляется под заказ
Печать
MONOCLONAL ANTI-GTF3A
Main image
Кат. №: SAB1409159-100UG
Производитель: Sigma-Aldrich
Кол-во:
Цена по запросу
Товар оформляется под заказ
Main image
Печать
MONOCLONAL ANTI-GTF3A
Кат. №: SAB1409159-100UG
Производитель: Sigma-Aldrich
Кол-во:
Цена по запросу
Товар оформляется под заказ
Description_x000D_ General description_x000D_ The product of this gene is a zinc finger protein with nine Cis[2]-His[2] zinc finger domains. It functions as an RNA polymerase III transcription factor to induce transcription of the 5S rRNA genes. The protein binds to a 50 bp internal promoter in the 5S genes called the internal control region (ICR), and nucleates formation of a stable preinitiation complex. This complex recruits the TFIIIC and TFIIIB transcription factors and RNA polymerase III to form the complete transcription complex. The protein is thought to be translated using a non-AUG translation initiation site in mammals based on sequence analysis, protein homology, and the size of the purified protein. (provided by RefSeq)_x000D_ Immunogen_x000D_ GTF3A (NP_002088, 185 a.a. ~ 274 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa._x000D_ Sequence_x000D_ NQQKQYICSFEDCKKTFKKHQQLKIHQCQNTNEPLFKCTQEGCGKHFASPSKLKRHAKAHEGYVCQKGCSFVAKTWTELLKHVRETHKEE_x000D_ Physical form_x000D_ Solution in phosphate buffered saline, pH 7.4
Related Categories
Alphabetical Index, Antibodies, GQ-GZ, Primary Antibodies conjugate
Дорогой клиент, на сайте внедрена нейросеть для сбора информации о товаре. Это может привести к незначительным расхождениям в характеристиках продукции.
Description_x000D_ General description_x000D_ The product of this gene is a zinc finger protein with nine Cis[2]-His[2] zinc finger domains. It functions as an RNA polymerase III transcription factor to induce transcription of the 5S rRNA genes. The protein binds to a 50 bp internal promoter in the 5S genes called the internal control region (ICR), and nucleates formation of a stable preinitiation complex. This complex recruits the TFIIIC and TFIIIB transcription factors and RNA polymerase III to form the complete transcription complex. The protein is thought to be translated using a non-AUG translation initiation site in mammals based on sequence analysis, protein homology, and the size of the purified protein. (provided by RefSeq)_x000D_ Immunogen_x000D_ GTF3A (NP_002088, 185 a.a. ~ 274 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa._x000D_ Sequence_x000D_ NQQKQYICSFEDCKKTFKKHQQLKIHQCQNTNEPLFKCTQEGCGKHFASPSKLKRHAKAHEGYVCQKGCSFVAKTWTELLKHVRETHKEE_x000D_ Physical form_x000D_ Solution in phosphate buffered saline, pH 7.4
Related Categories
Alphabetical Index, Antibodies, GQ-GZ, Primary Antibodies conjugate
Дорогой клиент, на сайте внедрена нейросеть для сбора информации о товаре. Это может привести к незначительным расхождениям в характеристиках продукции.