Description_x000D_ General description_x000D_ The enzyme encoded by this gene is classified as a thiolesterase and is responsible for the hydrolysis of S-lactoyl-glutathione to reduced glutathione and D-lactate. (provided by RefSeq)_x000D_ Immunogen_x000D_ HAGH (NP_005317, 161 a.a. ~ 260 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa._x000D_ Sequence_x000D_ GRLPPDTRVYCGHEYTINNLKFARHVEPGNAAIREKLAWAKEKYSIGEPTVPSTLAEEFTYNPFMRVREKTVQQHAGETDPVTTMRAVRREKDQFKMPRD_x000D_ Physical form_x000D_ Solution_x000D_ Legal Information_x000D_ GenBank is a registered trademark of United States Department of Health and Human Services