Description_x000D_ General description_x000D_ Hairy and enhancer of split-1 (HES1) is a transcriptional repressor. It is a member of the basic helix-loop-helix family of transcription factors. This gene is mapped to human chromosome 3q29._x000D_ This protein belongs to the basic helix-loop-helix family of transcription factors. It is a transcriptional repressor of genes that require a bHLH protein for their transcription. The protein has a particular type of basic domain that contains a helix interrupting protein that binds to the N-box rather than the canonical E-box. (provided by RefSeq)_x000D_ Immunogen_x000D_ HES1 (NP_005515, 36 a.a. ~ 142 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa._x000D_ Sequence_x000D_ KSSKPIMEKRRRARINESLSQLKTLILDALKKDSSRHSKLEKADILEMTVKHLRNLQRAQMTAALSTDPSVLGKYRAGFSECMNEVTRFLSTCEGVNTEVRTRLLGH_x000D_ Application_x000D_ Monoclonal Anti-HES1 antibody has been used in western blotting._x000D_ Physical form_x000D_ Solution in phosphate buffered saline, pH 7.4_x000D_ Disclaimer_x000D_ Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals._x000D_ Legal Information_x000D_ GenBank is a registered trademark of United States Department of Health and Human Services_x000D_ Biochem/physiol Actions_x000D_ Hairy and enhancer of split-1 (HES1) is required for regulating NPC (neural progenitor cells) fate and fetal brain development. This gene also helps to maintain the undifferentiated and proliferative status of NPCs. Absence of HES1 is linked with poor prognosis in colorectal adenocarcinoma.