Перейти к контенту
Main image
Печать
MONOCLONAL ANTI-HSPA4
Кат. №: SAB1402233-100UG
Производитель: Sigma-Aldrich
Кол-во:
Цена по запросу
Товар оформляется под заказ
Печать
MONOCLONAL ANTI-HSPA4
Main image
Кат. №: SAB1402233-100UG
Производитель: Sigma-Aldrich
Кол-во:
Цена по запросу
Товар оформляется под заказ
Main image
Печать
MONOCLONAL ANTI-HSPA4
Кат. №: SAB1402233-100UG
Производитель: Sigma-Aldrich
Кол-во:
Цена по запросу
Товар оформляется под заказ
Description_x000D_ Immunogen_x000D_ HSPA4 (AAH02526, 1 a.a. ~ 148 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa._x000D_ Sequence_x000D_ MSVVGIDLGFQSCYVAVARAGGIETIANEYSDRCTPACISFGPKNRSIGAAAKSQVISNAKNTVQGFKRFHGRAFSDPFVEAEKSNLAYDIVQLPTGLTGIKVTYMEEEQNGPVDGQGDNPGPQAAEQGTDTAVPSDSDKKLPEMDID_x000D_ Physical form_x000D_ Solution in phosphate buffered saline, pH 7.4_x000D_ Biochem/physiol Actions_x000D_ Hspa4 (heat shock protein family A (Hsp70) member 4) is an important ATP-dependent cytosolic chaperone along with Hsp90. Hspa4 aids in the folding of several proteins and helps in protecting against cellular stresses such as rise in temperature. Hspa4 maintains the function of the mitotic centrosome to coordinates bipolar mitotic spindle assembly. Hspa4 might compensate the loss of parkin function in mice by protecting the cells against proteolytic and mitochondrial stress. Therefore, it can serve as an important therapeutic agent for parkinson disease. Upregulation of HSPA4 is observed in parkin gene knockout mice. Hspa4 is known to be associated with tumor progression and offers resistance against many therapeutic agents. The gene is upregulated in many different types of cancer.
Related Categories
Alphabetical Index, Antibodies, HP-HT, Primary Antibodies conjugate
Дорогой клиент, на сайте внедрена нейросеть для сбора информации о товаре. Это может привести к незначительным расхождениям в характеристиках продукции.
Description_x000D_ Immunogen_x000D_ HSPA4 (AAH02526, 1 a.a. ~ 148 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa._x000D_ Sequence_x000D_ MSVVGIDLGFQSCYVAVARAGGIETIANEYSDRCTPACISFGPKNRSIGAAAKSQVISNAKNTVQGFKRFHGRAFSDPFVEAEKSNLAYDIVQLPTGLTGIKVTYMEEEQNGPVDGQGDNPGPQAAEQGTDTAVPSDSDKKLPEMDID_x000D_ Physical form_x000D_ Solution in phosphate buffered saline, pH 7.4_x000D_ Biochem/physiol Actions_x000D_ Hspa4 (heat shock protein family A (Hsp70) member 4) is an important ATP-dependent cytosolic chaperone along with Hsp90. Hspa4 aids in the folding of several proteins and helps in protecting against cellular stresses such as rise in temperature. Hspa4 maintains the function of the mitotic centrosome to coordinates bipolar mitotic spindle assembly. Hspa4 might compensate the loss of parkin function in mice by protecting the cells against proteolytic and mitochondrial stress. Therefore, it can serve as an important therapeutic agent for parkinson disease. Upregulation of HSPA4 is observed in parkin gene knockout mice. Hspa4 is known to be associated with tumor progression and offers resistance against many therapeutic agents. The gene is upregulated in many different types of cancer.
Related Categories
Alphabetical Index, Antibodies, HP-HT, Primary Antibodies conjugate
Дорогой клиент, на сайте внедрена нейросеть для сбора информации о товаре. Это может привести к незначительным расхождениям в характеристиках продукции.