Description_x000D_ General description_x000D_ The protein encoded by this gene belongs to the biotin and lipoic acid synthetases family. It localizes in mitochondrion and plays an important role in alpha-(+)-lipoic acid synthesis. It may also function in the sulfur insertion chemistry in lipoate biosynthesis. Alternative splicing occurs at this locus and two transcript variants encoding distinct isoforms have been identified. (provided by RefSeq)_x000D_ Immunogen_x000D_ LIAS (NP_006850, 273 a.a. ~ 372 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa._x000D_ Sequence_x000D_ ISKTSIMLGLGENDEQVYATMKALREADVDCLTLGQYMQPTRRHLKVEEYITPEKFKYWEKVGNELGFHYTASGPLVRSSYKAGEFFLKNLVAKRKTKDL_x000D_ Physical form_x000D_ Solution in phosphate buffered saline, pH 7.4_x000D_ Legal Information_x000D_ GenBank is a registered trademark of United States Department of Health and Human Services