Description_x000D_ General description_x000D_ Ligand of numb-protein X 2 (LNX2) is an E3 ubiquitin ligase and the gene encoding it is localized on chromosome 13q12.2._x000D_ Immunogen_x000D_ LNX2 (NP_699202, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa._x000D_ Sequence_x000D_ MGTTSDEMVSVEQTSSSSLNPLCFECGQQHWTRENHLYNYQNEVDDDLVCHICLQPLLQPLDTPCGHTFCYKCLRNFLQEKDFCPLDRKRLHFKLCKKSS_x000D_ Physical form_x000D_ Solution in phosphate buffered saline, pH 7.4_x000D_ Legal Information_x000D_ GenBank is a registered trademark of United States Department of Health and Human Services_x000D_ Biochem/physiol Actions_x000D_ Ligand of numb-protein X 2 (LNX2) modulates NOTCH signaling and WNT/β-catenin pathway. It associates with junction adhesion molecule 4 (JAM 4) and has a role in epithelial-mesenchymal transition. LNX2 has been shown to be upregulated in ovarian cancer.