Description_x000D_ Immunogen_x000D_ MARK3 (NP_002367.4, 402 a.a. ~ 500 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa._x000D_ Sequence_x000D_ HHKVQRSVFSSQKQRRYSDHAGPAIPSVVAYPKRSQTSTADSDLKEDGISSRKSSGSAVGGKGIAPASPMLGNASNPNKADIPERKKSSTVPSSNTASG_x000D_ Physical form_x000D_ Solution in phosphate buffered saline, pH 7.4_x000D_ Biochem/physiol Actions_x000D_ MARK3 (microtubule affinity regulating kinase 3) is activated by phosphorylation and is responsible for the phosphorylation of other proteins. Changes in the expression of MARK3 are associated with carcinogenesis.