Description_x000D_ General description_x000D_ Milk fat globule epidermal growth factor 8 (Mfge8) is a peripheral membrane soluble glycoprotein. It is liberated by several cells like macrophages. This protein is also termed as a phagocytosis “eat me” signal. It is predominantly expressed in lactating mammary glands.MFG-E8 has two-repeated EGF-like domains, a mucin-like domain, two-repeated discoidin-like domains (C-domains) and an integrin-binding motif (RGD sequence) in the EGF-like domain. This gene is located on human chromosome 15q26._x000D_ Immunogen_x000D_ MFGE8 (NP_005919, 61 a.a. ~ 170 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa._x000D_ Sequence_x000D_ YAGNHCETKCVEPLGMENGNIANSQIAASSVRVTFLGLQHWVPELARLNRAGMVNAWTPSSNDDNPWIQVNLLRRMWVTGVVTQGASRLASHEYLKAFKVAYSLNGHEFD_x000D_ Physical form_x000D_ Solution in phosphate buffered saline, pH 7.4_x000D_ Disclaimer_x000D_ Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals._x000D_ Legal Information_x000D_ GenBank is a registered trademark of United States Department of Health and Human Services_x000D_ Biochem/physiol Actions_x000D_ Milk fat globule epidermal growth factor 8 (Mfge8) controls inflammation and immunity by mediating apoptotic cell clearance. It plays an important role in autoimmunity, neoangiogenesis and sperm-egg binding. Mfge8 also plays a major role in membrane vesicle secretion like budding or shedding of plasma membrane (microvesicles) and exocytosis of endocytic multivesicular bodies (exosomes).