Description_x000D_ General description_x000D_ Opa interacting protein 5 (OIP5) codes for a 25 kDa protein that has a coiled-coil domain. It is also termed as Mis18beta and LINT-25. This gene is located on human chromosome 15q15.1._x000D_ Immunogen_x000D_ OIP5 (AAH15050, 1 a.a. ~ 229 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa._x000D_ Sequence_x000D_ MAAQPLRHRSRCATPPRGDFCGGTERAIDQASFTTSMEWDTQVVKGSSPLGPAGLGAEEPAAGPQLPSWLQPERCAVFQCAQCHAVLADSVHLAWDLSRSLGAVVFSRVTNNVVLEAPFLVGIEGSLKGSTYNLLFCGSCGIPVGFHLYSTHAALAALRGHFCLSSDKMVCYLLKTKAIVNASEMDIQNVPLSEKIAELKEKIVLTHNRLKSLMKILSEVTPDQSKPEN_x000D_ Physical form_x000D_ Solution in phosphate buffered saline, pH 7.4_x000D_ Legal Information_x000D_ GenBank is a registered trademark of United States Department of Health and Human Services_x000D_ Biochem/physiol Actions_x000D_ Opa interacting protein 5 (OIP5) is required for the structure and function of the centromere/kinetochore. Interaction of OIP5 with retinoblastoma protein modulates cell cycle progression via the E2 factor (E2F)-retinoblastoma (Rb) pathway. It initiates β-catenin signaling.