Description_x000D_ General description_x000D_ Peptidyl arginine deiminase 4 (PADI4) is one of the four PADIs found in humans. The protein consists of 663 amino acids. PADI4 gene is localized to human chromosome 1p36. It is expressed in hematopoietic tissues, such as spleen, thymus, peripheral blood leukocytes, fetal liver and bone marrow._x000D_ Immunogen_x000D_ PADI4 (NP_004247, 2 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa._x000D_ Sequence_x000D_ AQGTLIRVTPEQPTHAVCVLGTLTQLDICSSAPEDCTSFSINASPGVVVDIAHSPPAKKKSTGSSTWPLDPGVEVTLTMKAASGSTGDQKVQISYYGPKTPPVKALLYL_x000D_ Physical form_x000D_ Solution in phosphate buffered saline, pH 7.4_x000D_ Disclaimer_x000D_ Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals._x000D_ Legal Information_x000D_ GenBank is a registered trademark of United States Department of Health and Human Services_x000D_ Biochem/physiol Actions_x000D_ Peptidyl arginine deiminase 4 (PADI4) is responsible for the post-translational conversion of peptidylarginine to citrulline, in the presence of calcium ions. In individuals with rheumatoid arthritis (RA), this gene is expressed in hematological cells and synovial tissues, and variant in this gene is linked with susceptibility to RA. The expression of this protein is linked with DNA hypermethylation in acute promyelocytic leukemia (APL).