Печать
MONOCLONAL ANTI-PARK2
Кат. №: WH0005071M1-100UG
Производитель: Sigma-Aldrich
Кол-во:
Цена по запросу
Товар оформляется под заказ
Печать
MONOCLONAL ANTI-PARK2
Кат. №: WH0005071M1-100UG
Производитель: Sigma-Aldrich
Кол-во:
Цена по запросу
Товар оформляется под заказ
Кол-во:
Цена по запросу
Товар оформляется под заказ
Description_x000D_
General description_x000D_
The parkin RBR E3 ubiquitin protein ligase (PARK2) gene, with 12 exons spanning 1.35Mb on genomic DNA, is mapped to human chromosome 6q26. The gene codes for E3 ubiquitin-protein ligase parkin. The protein contains conserved ubiquitin-like domain (UBL) at N- terminal and four zinc coordinating domains, such as, RING0, RING1, in between ring (IBR) and RING2 domains at C-terminal._x000D_
The precise function of this gene is unknown; however, the encoded protein is a component of a multiprotein E3 ubiquitin ligase complex that mediates the targeting of substrate proteins for proteasomal degradation. Mutations in this gene are known to cause Parkinson disease and autosomal recessive juvenile Parkinson disease. Alternative splicing of this gene produces multiple transcript variants encoding distinct isoforms. Additional splice variants of this gene have been described but currently lack transcript support. (provided by RefSeq)_x000D_
Immunogen_x000D_
PARK2 (AAH22014, 288 a.a. ~ 387 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa._x000D_
Sequence_x000D_
PCVGTGDTVVLRGALGGFRRGVAGCPNSLIKELHHFRILGEEQYNRYQQYGAEECVLQMGGVLCPRPGCGAGLLPEPDQRKVTCEGGNGLGCGYGQRRTK_x000D_
Physical form_x000D_
Solution in phosphate buffered saline, pH 7.4_x000D_
Disclaimer_x000D_
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals._x000D_
Legal Information_x000D_
GenBank is a registered trademark of United States Department of Health and Human Services_x000D_
Biochem/physiol Actions_x000D_
Parkin RBR E3 ubiquitin protein ligase (PARK2) catalyzes the monoubiquitination and polyubiquitination of proteins to regulate various cellular processes. The encoded protein plays a vital role in synaptic regulation. Genetic variations in the gene leads to autosomal recessive Parkinson’s disease (AR-PD) and sporadic PD.
Related Categories
Alphabetical Index, Antibodies, Antibodies for Cell Biology, Antibodies for Parkinson’s Disease Research, Antibodies to E1,E2,E3 Ligase, Antibodies to Protein Degradation, Cell Biology, Cell Signaling and Neuroscience, Neurobiology, Neuroscience, P-PA, Parkinson′s Disease, Primary Antibodies, Products for Neurodegenerative Disease ResearchMore... conjugate
Дорогой клиент, на сайте внедрена нейросеть для сбора информации о товаре. Это может привести к незначительным расхождениям в характеристиках продукции.
