Description_x000D_ General description_x000D_ Member of RAS oncogene family, RAB15 is a GTPase expressed in the brain._x000D_ Immunogen_x000D_ RAB15 (AAH40679, 99 a.a. ~ 208 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa._x000D_ Sequence_x000D_ IMKWVSDVDEVGDATSLPGCGEGASPGKARRGPDGKANASRKLCLPQPWMKTSGTHQKASRRSLLGIRLMRSRNGRWEESKGSSWRRSMAWTSMKQVPAPTSTLKSHSRV_x000D_ Physical form_x000D_ Solution in phosphate buffered saline, pH 7.4_x000D_ Legal Information_x000D_ GenBank is a registered trademark of United States Department of Health and Human Services_x000D_ Biochem/physiol Actions_x000D_ Member of RAS oncogene family, RAB15, has a role in endocytosis. It is a target of the protein atonal homolog 1 (Atoh1), a neural transcription factor. RAB15 has been linked to neuroblastoma.