Description_x000D_ Immunogen_x000D_ RABEP1 (NP_004694.2, 765 a.a. ~ 862 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa._x000D_ Sequence_x000D_ KSQQLESLQEIKISLEEQLKKETAAKATVEQLMFEEKNKAQRLQTELDVSEQVQRDFVKLSQTLQVQLERIRQADSLERIRAILNDTKLTDINQLPET_x000D_ Physical form_x000D_ Solution in phosphate buffered saline, pH 7.4_x000D_ Biochem/physiol Actions_x000D_ RABEP1 (Rab GTPase-binding effector protein 1) is an effector of Rab5 and plays an important role in homotypic and heterotypic fusions of early endosomes. Absence of RABEP1 suppresses Rab5-associated early endosome fusion.