Перейти к контенту
Main image
Печать
MONOCLONAL ANTI-RASD1
Кат. №: WH0051655M1-100UG
Производитель: Sigma-Aldrich
Кол-во:
Цена по запросу
Товар оформляется под заказ
Печать
MONOCLONAL ANTI-RASD1
Main image
Кат. №: WH0051655M1-100UG
Производитель: Sigma-Aldrich
Кол-во:
Цена по запросу
Товар оформляется под заказ
Main image
Печать
MONOCLONAL ANTI-RASD1
Кат. №: WH0051655M1-100UG
Производитель: Sigma-Aldrich
Кол-во:
Цена по запросу
Товар оформляется под заказ
Description_x000D_ General description_x000D_ This gene encodes a Ras-related protein that is stimulated by dexamethasone. The exact function of this gene is unknown, but it may play a role in dexamethasone-induced alterations in cell morphology, growth and cell-extracellular matrix interactions. In addition, studies of a similar rat protein suggest that it functions as as a novel physiologic nitric oxide (NO) effector. The gene product belongs to the Ras superfamily of small GTPases. (provided by RefSeq)_x000D_ Immunogen_x000D_ RASD1 (AAH18041, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa._x000D_ Sequence_x000D_ MKLAAMIKKMCPSDSELSIPAKNCYRMVILGSSKVGKTAIVSRFLTGRFEDAYTPTIEDFHRKFYSIRGEVYQLDILDTSGNHPFPAMRRLSILTGDVFILVFSLDNRDS_x000D_ Physical form_x000D_ Solution in phosphate buffered saline, pH 7.4_x000D_ Legal Information_x000D_ GenBank is a registered trademark of United States Department of Health and Human Services
Related Categories
Alphabetical Index, Antibodies, Primary Antibodies, RAE-RAX conjugate
Дорогой клиент, на сайте внедрена нейросеть для сбора информации о товаре. Это может привести к незначительным расхождениям в характеристиках продукции.
Description_x000D_ General description_x000D_ This gene encodes a Ras-related protein that is stimulated by dexamethasone. The exact function of this gene is unknown, but it may play a role in dexamethasone-induced alterations in cell morphology, growth and cell-extracellular matrix interactions. In addition, studies of a similar rat protein suggest that it functions as as a novel physiologic nitric oxide (NO) effector. The gene product belongs to the Ras superfamily of small GTPases. (provided by RefSeq)_x000D_ Immunogen_x000D_ RASD1 (AAH18041, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa._x000D_ Sequence_x000D_ MKLAAMIKKMCPSDSELSIPAKNCYRMVILGSSKVGKTAIVSRFLTGRFEDAYTPTIEDFHRKFYSIRGEVYQLDILDTSGNHPFPAMRRLSILTGDVFILVFSLDNRDS_x000D_ Physical form_x000D_ Solution in phosphate buffered saline, pH 7.4_x000D_ Legal Information_x000D_ GenBank is a registered trademark of United States Department of Health and Human Services
Related Categories
Alphabetical Index, Antibodies, Primary Antibodies, RAE-RAX conjugate
Дорогой клиент, на сайте внедрена нейросеть для сбора информации о товаре. Это может привести к незначительным расхождениям в характеристиках продукции.