Перейти к контенту
Main image
Печать
MONOCLONAL ANTI-RBM15
Кат. №: SAB1409662-100UG
Производитель: Sigma-Aldrich
Кол-во:
Цена по запросу
Товар оформляется под заказ
Печать
MONOCLONAL ANTI-RBM15
Main image
Кат. №: SAB1409662-100UG
Производитель: Sigma-Aldrich
Кол-во:
Цена по запросу
Товар оформляется под заказ
Main image
Печать
MONOCLONAL ANTI-RBM15
Кат. №: SAB1409662-100UG
Производитель: Sigma-Aldrich
Кол-во:
Цена по запросу
Товар оформляется под заказ
Description_x000D_ General description_x000D_ Members of the SPEN (Split-end) family of proteins, including RBM15, have repressor function in several signaling pathways and may bind to RNA through interaction with spliceosome components (Hiriart et al., 2005 [PubMed 16129689]).[supplied by OMIM_x000D_ Immunogen_x000D_ RBM15 (NP_073605.4, 701 a.a. ~ 810 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa._x000D_ Sequence_x000D_ PIRDRRGSLEKSQGDKRDRKNSASAERDRKHRTTAPTEGKSPLKKEDRSDGSAPSTSTASSKLKSPSQKQDGGTAPVASASPKLCLAWQGMLLLKNSNFPSNMHLLQGDL_x000D_ Physical form_x000D_ Solution in phosphate buffered saline, pH 7.4_x000D_ Biochem/physiol Actions_x000D_ RBM15 (RNA binding motif protein 15) is an RTE (RNA transport element) binding factor majorly involved in the mRNA export. It plays a vital role in the NXF (Nuclear export factor) pathway. It directly binds to NXF1 and provides receptor for the RNA export element RTE. This conjugated form helps to enhance RTE-mediated expression. RBM15 has the ability to identify specific RTE RNA in vitro, which finally enhances export and expression of RTE-containing reporter mRNAs in vivo.
Related Categories
Alphabetical Index, Antibodies, Primary Antibodies, RB-RG conjugate
Дорогой клиент, на сайте внедрена нейросеть для сбора информации о товаре. Это может привести к незначительным расхождениям в характеристиках продукции.
Description_x000D_ General description_x000D_ Members of the SPEN (Split-end) family of proteins, including RBM15, have repressor function in several signaling pathways and may bind to RNA through interaction with spliceosome components (Hiriart et al., 2005 [PubMed 16129689]).[supplied by OMIM_x000D_ Immunogen_x000D_ RBM15 (NP_073605.4, 701 a.a. ~ 810 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa._x000D_ Sequence_x000D_ PIRDRRGSLEKSQGDKRDRKNSASAERDRKHRTTAPTEGKSPLKKEDRSDGSAPSTSTASSKLKSPSQKQDGGTAPVASASPKLCLAWQGMLLLKNSNFPSNMHLLQGDL_x000D_ Physical form_x000D_ Solution in phosphate buffered saline, pH 7.4_x000D_ Biochem/physiol Actions_x000D_ RBM15 (RNA binding motif protein 15) is an RTE (RNA transport element) binding factor majorly involved in the mRNA export. It plays a vital role in the NXF (Nuclear export factor) pathway. It directly binds to NXF1 and provides receptor for the RNA export element RTE. This conjugated form helps to enhance RTE-mediated expression. RBM15 has the ability to identify specific RTE RNA in vitro, which finally enhances export and expression of RTE-containing reporter mRNAs in vivo.
Related Categories
Alphabetical Index, Antibodies, Primary Antibodies, RB-RG conjugate
Дорогой клиент, на сайте внедрена нейросеть для сбора информации о товаре. Это может привести к незначительным расхождениям в характеристиках продукции.