Перейти к контенту
Main image
Печать
MONOCLONAL ANTI-SLK
Кат. №: WH0009748M1-100UG
Производитель: Sigma-Aldrich
Кол-во:
Цена по запросу
Товар оформляется под заказ
Печать
MONOCLONAL ANTI-SLK
Main image
Кат. №: WH0009748M1-100UG
Производитель: Sigma-Aldrich
Кол-во:
Цена по запросу
Товар оформляется под заказ
Main image
Печать
MONOCLONAL ANTI-SLK
Кат. №: WH0009748M1-100UG
Производитель: Sigma-Aldrich
Кол-во:
Цена по запросу
Товар оформляется под заказ
Description_x000D_ General description_x000D_ STE20 like kinase (SLK) is a 1204 amino acid serine/threonine kinase. It possesses a kinase domain located at the amino-terminal and a C-terminal regulatory domain with coiled-coils. SLK is group V germinal center kinase that is expressed in the nucleus, cytosol, microtubules and centrosomes. The SLK gene is localized on human chromosome 10q24.33._x000D_ Immunogen_x000D_ SLK (NP_055535, 1126 a.a. ~ 1235 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa._x000D_ Sequence_x000D_ KHENQMRDLQLQCEANVRELHQLQNEKCHLLVEHETQKLKELDEEHSQELKEWREKLRPRKKTLEEEFARKLQEQEVFFKMTGESECLNPSTQSRISKFYPIPSLHSTGS_x000D_ Physical form_x000D_ Solution in phosphate buffered saline, pH 7.4_x000D_ Legal Information_x000D_ GenBank is a registered trademark of United States Department of Health and Human Services_x000D_ Biochem/physiol Actions_x000D_ STE20 like kinase (SLK) is a modulator of cell motility. It phosphorylates cytoskeleton-bound proteins, which take part in the remodeling of migratory cell architecture. SLK is also involved in mitogen-activated protein kinase pathways. It acts as an activator of Jun N-terminal kinase (JNK) and transactivates tumor suppressor p53.
Related Categories
Alphabetical Index, Antibodies, Primary Antibodies, SLC3-SLZ conjugate
Дорогой клиент, на сайте внедрена нейросеть для сбора информации о товаре. Это может привести к незначительным расхождениям в характеристиках продукции.
Description_x000D_ General description_x000D_ STE20 like kinase (SLK) is a 1204 amino acid serine/threonine kinase. It possesses a kinase domain located at the amino-terminal and a C-terminal regulatory domain with coiled-coils. SLK is group V germinal center kinase that is expressed in the nucleus, cytosol, microtubules and centrosomes. The SLK gene is localized on human chromosome 10q24.33._x000D_ Immunogen_x000D_ SLK (NP_055535, 1126 a.a. ~ 1235 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa._x000D_ Sequence_x000D_ KHENQMRDLQLQCEANVRELHQLQNEKCHLLVEHETQKLKELDEEHSQELKEWREKLRPRKKTLEEEFARKLQEQEVFFKMTGESECLNPSTQSRISKFYPIPSLHSTGS_x000D_ Physical form_x000D_ Solution in phosphate buffered saline, pH 7.4_x000D_ Legal Information_x000D_ GenBank is a registered trademark of United States Department of Health and Human Services_x000D_ Biochem/physiol Actions_x000D_ STE20 like kinase (SLK) is a modulator of cell motility. It phosphorylates cytoskeleton-bound proteins, which take part in the remodeling of migratory cell architecture. SLK is also involved in mitogen-activated protein kinase pathways. It acts as an activator of Jun N-terminal kinase (JNK) and transactivates tumor suppressor p53.
Related Categories
Alphabetical Index, Antibodies, Primary Antibodies, SLC3-SLZ conjugate
Дорогой клиент, на сайте внедрена нейросеть для сбора информации о товаре. Это может привести к незначительным расхождениям в характеристиках продукции.