Description_x000D_ General description_x000D_ TBC1 domain family member 8 (TBC1D8) gene is located on human chromosome 2q11.2._x000D_ Immunogen_x000D_ TBC1D8 (NP_008994, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa._x000D_ Sequence_x000D_ MEQLADVTLRRLLDNEVFDLDPDLQEPSQITKRDLEARAQNEFFRAFFRLPRKEKLHAVVDCSLWTPFSRCHTAGRMFASDSYICFASREDGCCKIILPLREVVSIEKME_x000D_ Physical form_x000D_ Solution in phosphate buffered saline, pH 7.4_x000D_ Legal Information_x000D_ GenBank is a registered trademark of United States Department of Health and Human Services_x000D_ Biochem/physiol Actions_x000D_ TBC1 domain family member 8 (TBC1D8) is involved in blood coagulation and circulation. It functions as a GTPase-activating protein for the Rab family. The protein is associated with membrane trafficking.