Перейти к контенту
Main image
Печать
MONOCLONAL ANTI-TBX6
Кат. №: WH0006911M1-100UG
Производитель: Sigma-Aldrich
Кол-во:
Цена по запросу
Товар оформляется под заказ
Печать
MONOCLONAL ANTI-TBX6
Main image
Кат. №: WH0006911M1-100UG
Производитель: Sigma-Aldrich
Кол-во:
Цена по запросу
Товар оформляется под заказ
Main image
Печать
MONOCLONAL ANTI-TBX6
Кат. №: WH0006911M1-100UG
Производитель: Sigma-Aldrich
Кол-во:
Цена по запросу
Товар оформляется под заказ
Description_x000D_ General description_x000D_ This gene is a member of a phylogenetically conserved family of genes that share a common DNA-binding domain, the T-box. T-box genes encode transcription factors involved in the regulation of developmental processes. Knockout studies in mice indicate that this gene is important for specification of paraxial mesoderm structures. (provided by RefSeq)_x000D_ Immunogen_x000D_ TBX6 (NP_004599, 191 a.a. ~ 299 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa._x000D_ Sequence_x000D_ SFHRVKLTNSTLDPHGHLILHSMHKYQPRIHLVRAAQLCSQHWGGMASFRFPETTFISVTAYQNPQITQLKIAANPFAKGFRENGRNCKRERDARVKRKLRGPEPAATE_x000D_ Physical form_x000D_ Solution in phosphate buffered saline, pH 7.4_x000D_ Legal Information_x000D_ GenBank is a registered trademark of United States Department of Health and Human Services
Related Categories
Alphabetical Index, Antibodies, Antibodies for Epigenetics and Nuclear Signaling, Antibodies to Transcription Factors, Primary Antibodies, SP - TF, T-TBMore... conjugate
Дорогой клиент, на сайте внедрена нейросеть для сбора информации о товаре. Это может привести к незначительным расхождениям в характеристиках продукции.
Description_x000D_ General description_x000D_ This gene is a member of a phylogenetically conserved family of genes that share a common DNA-binding domain, the T-box. T-box genes encode transcription factors involved in the regulation of developmental processes. Knockout studies in mice indicate that this gene is important for specification of paraxial mesoderm structures. (provided by RefSeq)_x000D_ Immunogen_x000D_ TBX6 (NP_004599, 191 a.a. ~ 299 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa._x000D_ Sequence_x000D_ SFHRVKLTNSTLDPHGHLILHSMHKYQPRIHLVRAAQLCSQHWGGMASFRFPETTFISVTAYQNPQITQLKIAANPFAKGFRENGRNCKRERDARVKRKLRGPEPAATE_x000D_ Physical form_x000D_ Solution in phosphate buffered saline, pH 7.4_x000D_ Legal Information_x000D_ GenBank is a registered trademark of United States Department of Health and Human Services
Related Categories
Alphabetical Index, Antibodies, Antibodies for Epigenetics and Nuclear Signaling, Antibodies to Transcription Factors, Primary Antibodies, SP - TF, T-TBMore... conjugate
Дорогой клиент, на сайте внедрена нейросеть для сбора информации о товаре. Это может привести к незначительным расхождениям в характеристиках продукции.