Description_x000D_ General description_x000D_ Tumor necrosis factor receptor superfamily, member 25 (TNFRSF25), also known as death receptor 3 (DR3) is a member of the TNF superfamily. It is expressed in lymphocyte rich tissues such as blood, thymus and spleen. The gene encoding TNFRSF25 is localized on human chromosome 1p36.31._x000D_ Immunogen_x000D_ TNFRSF25 (NP_003781, 28 a.a. ~ 124 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa._x000D_ Sequence_x000D_ TRSPRCDCAGDFHKKIGLFCCRGCPAGHYLKAPCTEPCGNSTCLVCPQDTFLAWENHHNSECARCQACDEQASQVALENCSAVADTRCGCKPGWFVE_x000D_ Physical form_x000D_ Solution in phosphate buffered saline, pH 7.4_x000D_ Disclaimer_x000D_ Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals._x000D_ Legal Information_x000D_ GenBank is a registered trademark of United States Department of Health and Human Services_x000D_ Biochem/physiol Actions_x000D_ Tumor necrosis factor receptor superfamily, member 25 (TNFRSF25) or death receptor 3 (DR3) is a death domain-containing receptor that is involved in inducing apoptosis or programmed cell death in cells. Binding of the ligand to these receptors sends signals that activate members of the caspase family of proteases, which cause the degradation of chromosomal DNA by activating DNase. It also activates nuclear factor κ-B (NF-κB), a protein complex that controls transcription of DNA.