Description_x000D_ General description_x000D_ Troponin I3, cardiac type (TNNI3), also known as cardiac troponin I (cTnI), is the inhibitory element of troponin. It possesses an inhibitory peptide (IP) domain and a switch peptide (SP) domain that is located N-terminal of the IP domain. The gene encoding TNNI3 is localized on human chromosome 19q13.42._x000D_ Immunogen_x000D_ TNNI3 (NP_000354, 102 a.a. ~ 210 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa._x000D_ Sequence_x000D_ ARVDKVDEERYDIEAKVTKNITEIADLTQKIFDLRGKFKRPTLRRVRISADAMMQALLGARAKESLDLRAHLKQVKKEDTEKENREVGDWRKNIDALSGMEGRKKKFES_x000D_ Physical form_x000D_ Solution in phosphate buffered saline, pH 7.4_x000D_ Disclaimer_x000D_ Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals._x000D_ Legal Information_x000D_ GenBank is a registered trademark of United States Department of Health and Human Services_x000D_ Biochem/physiol Actions_x000D_ Troponin I3, cardiac type (TNNI3) or cardiac troponin I (cTnI) modulates the diastolic function of the heart. Low expression of TNNI3 is associated with cardiac diastolic dysfunction. Elevated expression of the protein indicates cardiac injury. TNNI3 is a biomarker for myocardial infarction and mutations in the gene encoding it have been linked to hypertrophic cardiomyopathy.