Перейти к контенту
Main image
Печать
MONOCLONAL ANTI-UBE2U
Кат. №: WH0148581M7-100UG
Производитель: Sigma-Aldrich
Кол-во:
Цена по запросу
Товар оформляется под заказ
Печать
MONOCLONAL ANTI-UBE2U
Main image
Кат. №: WH0148581M7-100UG
Производитель: Sigma-Aldrich
Кол-во:
Цена по запросу
Товар оформляется под заказ
Main image
Печать
MONOCLONAL ANTI-UBE2U
Кат. №: WH0148581M7-100UG
Производитель: Sigma-Aldrich
Кол-во:
Цена по запросу
Товар оформляется под заказ
Description_x000D_ General description_x000D_ UBE2U (Ubiquitin-conjugating enzyme E2U) is an E2 enzyme belonging to the class III group of UbcH5 family of highly homologous E2s family. It consists of an extended C-terminal tail region attached to its UBC-fold. Its mRNA expression has been reported in the urogenital tract._x000D_ Immunogen_x000D_ UBE2U (NP_689702.1, 9 a.a. ~ 102 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa._x000D_ Sequence_x000D_ LHRDFCDLKENNYKGITAKPVSEDMMEWEVEIEGLQNSVWQGLVFQLTIHFTSEYNYAPPVVKFITIPFHPNVDPHTGQPCIDFLDNPEKWNTN_x000D_ Physical form_x000D_ Solution in phosphate buffered saline, pH 7.4_x000D_ Legal Information_x000D_ GenBank is a registered trademark of United States Department of Health and Human Services_x000D_ Biochem/physiol Actions_x000D_ UBE2U (Ubiquitin-conjugating enzyme E2U) plays a vital role in the formation of E2-RING E3 network in the human ubiquitin-proteasome system. It acts as a hub protein in direct interaction with E3 ligase, MDM2. It links and holds E2-E3 network together for the ubiquitination activity, which finally transfer the ubiquitin to the E3-bound substrate. The protein also plays a role in the protein degradation process of misfolded and short-lived proteins.
Related Categories
Alphabetical Index, Antibodies, Primary Antibodies, U1-UG conjugate
Дорогой клиент, на сайте внедрена нейросеть для сбора информации о товаре. Это может привести к незначительным расхождениям в характеристиках продукции.
Description_x000D_ General description_x000D_ UBE2U (Ubiquitin-conjugating enzyme E2U) is an E2 enzyme belonging to the class III group of UbcH5 family of highly homologous E2s family. It consists of an extended C-terminal tail region attached to its UBC-fold. Its mRNA expression has been reported in the urogenital tract._x000D_ Immunogen_x000D_ UBE2U (NP_689702.1, 9 a.a. ~ 102 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa._x000D_ Sequence_x000D_ LHRDFCDLKENNYKGITAKPVSEDMMEWEVEIEGLQNSVWQGLVFQLTIHFTSEYNYAPPVVKFITIPFHPNVDPHTGQPCIDFLDNPEKWNTN_x000D_ Physical form_x000D_ Solution in phosphate buffered saline, pH 7.4_x000D_ Legal Information_x000D_ GenBank is a registered trademark of United States Department of Health and Human Services_x000D_ Biochem/physiol Actions_x000D_ UBE2U (Ubiquitin-conjugating enzyme E2U) plays a vital role in the formation of E2-RING E3 network in the human ubiquitin-proteasome system. It acts as a hub protein in direct interaction with E3 ligase, MDM2. It links and holds E2-E3 network together for the ubiquitination activity, which finally transfer the ubiquitin to the E3-bound substrate. The protein also plays a role in the protein degradation process of misfolded and short-lived proteins.
Related Categories
Alphabetical Index, Antibodies, Primary Antibodies, U1-UG conjugate
Дорогой клиент, на сайте внедрена нейросеть для сбора информации о товаре. Это может привести к незначительным расхождениям в характеристиках продукции.