Description_x000D_ General description_x000D_ Ubiquitin specific peptidase 14 (USP14) is a 494 amino acid protein containing a 45kDa catalytic domain at its amino-terminus. Its ubiquitin-like (Ubl) domain associates with 19S regulatory particle (RP) 26S proteasome. This binding activates the deubiquitinating activity of the protein. USP14 is part of the ubiquitin-specific processing (UBP) family of proteases._x000D_ Immunogen_x000D_ USP14 (NP_005142, 395 a.a. ~ 494 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa._x000D_ Sequence_x000D_ PQKEVKYEPFSFADDIGSNNCGYYDLQAVLTHQGRSSSSGHYVSWVKRKQDEWIKFDDDKVSIVTPEDILRLSGGGDWHIAYVLLYGPRRVEIMEEESEQ_x000D_ Physical form_x000D_ Solution in phosphate buffered saline, pH 7.4_x000D_ Disclaimer_x000D_ Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals._x000D_ Legal Information_x000D_ GenBank is a registered trademark of United States Department of Health and Human Services_x000D_ Biochem/physiol Actions_x000D_ Ubiquitin specific peptidase 14 (USP14) releases ubiquitin from the proteasome-targeted ubiquitinated proteins resulting in regeneration of ubiquitin at the proteasome. It is involved in the degradation of chemokine receptor CXCR4. Under endoplasmic reticulum (ER) stress, USp14 binds to ER stress receptor, which is involved in unfolded protein response (UPR), a mechanism to control the accumulation of unfolded proteins within the ER lumen. Its overexpression leads to ER-associated degradation (ERAD) pathway inhibition.