Перейти к контенту
Main image
Печать
MONOCLONAL ANTI-ZIC4
Кат. №: SAB1409881-100UG
Производитель: Sigma-Aldrich
Кол-во:
Цена по запросу
Товар оформляется под заказ
Печать
MONOCLONAL ANTI-ZIC4
Main image
Кат. №: SAB1409881-100UG
Производитель: Sigma-Aldrich
Кол-во:
Цена по запросу
Товар оформляется под заказ
Main image
Печать
MONOCLONAL ANTI-ZIC4
Кат. №: SAB1409881-100UG
Производитель: Sigma-Aldrich
Кол-во:
Цена по запросу
Товар оформляется под заказ
Description_x000D_ General description_x000D_ This gene encodes a member of the ZIC family of C2H2-type zinc finger proteins. Members of this family are important during development, and have been associated with X-linked visceral heterotaxy and holoprosencephaly type 5. This gene is closely linked to the gene encoding zinc finger protein of the cerebellum 1, a related family member on chromosome 3. This gene encodes a protein of unknown function. (provided by RefSeq)_x000D_ Immunogen_x000D_ ZIC4 (NP_115529, 1 a.a. ~ 90 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa._x000D_ Sequence_x000D_ MRYKTSLVMRKRLRLYRNTLKESSSSSGHHGPQLTAASSPSVFPGLHEEPPQASPSRPLNGLLRLGLPGDMYARPEPFPPGPAARSDALA_x000D_ Physical form_x000D_ Solution in phosphate buffered saline, pH 7.4
Related Categories
Alphabetical Index, Antibodies, Primary Antibodies, ZA-ZM conjugate
Дорогой клиент, на сайте внедрена нейросеть для сбора информации о товаре. Это может привести к незначительным расхождениям в характеристиках продукции.
Description_x000D_ General description_x000D_ This gene encodes a member of the ZIC family of C2H2-type zinc finger proteins. Members of this family are important during development, and have been associated with X-linked visceral heterotaxy and holoprosencephaly type 5. This gene is closely linked to the gene encoding zinc finger protein of the cerebellum 1, a related family member on chromosome 3. This gene encodes a protein of unknown function. (provided by RefSeq)_x000D_ Immunogen_x000D_ ZIC4 (NP_115529, 1 a.a. ~ 90 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa._x000D_ Sequence_x000D_ MRYKTSLVMRKRLRLYRNTLKESSSSSGHHGPQLTAASSPSVFPGLHEEPPQASPSRPLNGLLRLGLPGDMYARPEPFPPGPAARSDALA_x000D_ Physical form_x000D_ Solution in phosphate buffered saline, pH 7.4
Related Categories
Alphabetical Index, Antibodies, Primary Antibodies, ZA-ZM conjugate
Дорогой клиент, на сайте внедрена нейросеть для сбора информации о товаре. Это может привести к незначительным расхождениям в характеристиках продукции.