Description_x000D_ General description_x000D_ SILu™Lite TIMP2 is a recombinant human protein expressed in human 293 cells. It consists of 194 amino acids, with a calculated molecular mass of 21.7 kDa. SILu™Lite TIMP2 is an analytical standard designed to be used as starting material for preparation of calibrators and controls in LC-MS applications._x000D_ Biochem/physiol Actions_x000D_ While the mammalian TIMP family has four members, TIMP-2 is a unique family member in that in addition to inhibiting matrix metalloproteinases (MMPs), TIMP-2 selectively interacts with MT1-MMP to facilitate the cell-surface activation of pro-MMP-2.1 Thus, TIMP-2 functions both as an inhibitor of MMPs, and is required for the cellular mechanism of pro-MMP-2 activation. Recently, it was validated that combination of TIMP-2 with another urinary cell-cycle arrest biomarkers, i.e. the insulin-like growth factor-binding protein 7 (IGFBP7) may predict the risk of moderate and severe acute kidney injury (AKI) in critically ill patients. For postoperative surgical intensive care unit patients, a single urinary TIMP2•IGFBP7 test accurately identified patients at risk for developing AKI within the ensuing 12 hours and its inclusion in clinical risk prediction models significantly enhances their performance._x000D_ Sequence_x000D_ CSCSPVHPQQAFCNADVVIRAKAVSEKEVDSGNDIYGNPIKRIQYEIKQIKMFKGPEKDIEFIYTAPSSAVCGVSLDVGGKKEYLIAGKAEGDGKMHITLCDFIVPWDTLSTTQKKSLNHRYQMGCECKITRCPMIPCYISSPDECLWMDWVTEKNINGHQAKFFACIKRSDGSCAWYRGAAPPKQEFLDIEDP_x000D_ Physical form_x000D_ Supplied as a lyophilized powder containing phosphate buffered saline._x000D_ Legal Information_x000D_ SILu is a trademark of Sigma-Aldrich Co. LLC